SCOPe 2.06: Domain d1wg2a1: 1wg2 A:8-58

Lineage for d1wg2a1 (1wg2 A:8-58)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.80: AN1-like Zinc finger [118309] (1 superfamily)
   dimetal(zinc)-bound alpha+beta fold; partial similarity to the Cysteine-rich domain fold (57888)

4. Superfamily g.80.1: AN1-like Zinc finger [118310] (1 family)

5. Family g.80.1.1: AN1-like Zinc finger [118311] (6 proteins)
   Pfam PF01428

6. Protein Zinc finger A20 and AN1 domains containing protein At1g12040 [118322] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118323] (1 PDB entry)
   Uniprot Q9SZ69 106-156

8. Domain d1wg2a1: 1wg2 A:8-58 [114600]
   Other proteins in same PDB: d1wg2a2, d1wg2a3
   Structural genomics target
   complexed with zn

Details for d1wg2a1

PDB Entry: 1wg2

PDB Description: solution structure of zf-an1 domain from arabidopsis thaliana

PDB Compounds: (A:) zinc finger (AN1-like) family protein

SCOPe Domain Sequences for d1wg2a1:

Sequence; same for both SEQRES and ATOM records:

>d1wg2a1 g.80.1.1 (A:8-58) Zinc finger A20 and AN1 domains containing protein At1g12040 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
psrpvrpnnrcfscnkkvgvmgfkckcgstfcgshrypekhecsfdfkevg

Timeline for d1wg2a1:

• d1wg2a1 first appeared in SCOP 1.71, called d1wg2a_
  
• d1wg2a1 was called d1wg2a_ in SCOPe 2.05
  
• d1wg2a1 appears in SCOPe 2.07
  
• d1wg2a1 appears in the current release, SCOPe 2.08