Lineage for d1wg2a1 (1wg2 A:8-58)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038716Fold g.80: AN1-like Zinc finger [118309] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold; partial similarity to the Cysteine-rich domain fold (57888)
  4. 3038717Superfamily g.80.1: AN1-like Zinc finger [118310] (1 family) (S)
  5. 3038718Family g.80.1.1: AN1-like Zinc finger [118311] (6 proteins)
    Pfam PF01428
  6. 3038725Protein Zinc finger A20 and AN1 domains containing protein At1g12040 [118322] (1 species)
  7. 3038726Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118323] (1 PDB entry)
    Uniprot Q9SZ69 106-156
  8. 3038727Domain d1wg2a1: 1wg2 A:8-58 [114600]
    Other proteins in same PDB: d1wg2a2, d1wg2a3
    Structural genomics target
    complexed with zn

Details for d1wg2a1

PDB Entry: 1wg2 (more details)

PDB Description: solution structure of zf-an1 domain from arabidopsis thaliana
PDB Compounds: (A:) zinc finger (AN1-like) family protein

SCOPe Domain Sequences for d1wg2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wg2a1 g.80.1.1 (A:8-58) Zinc finger A20 and AN1 domains containing protein At1g12040 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
psrpvrpnnrcfscnkkvgvmgfkckcgstfcgshrypekhecsfdfkevg

SCOPe Domain Coordinates for d1wg2a1:

Click to download the PDB-style file with coordinates for d1wg2a1.
(The format of our PDB-style files is described here.)

Timeline for d1wg2a1: