SCOP 1.73: Domain d1wg1a_: 1wg1 A:

Lineage for d1wg1a_ (1wg1 A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families)

5. Family d.58.7.1: Canonical RBD [54929] (67 proteins)

6. Protein Probable RNA-binding protein KIAA1579 [117963] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117964] (1 PDB entry)

8. Domain d1wg1a_: 1wg1 A: [114599]
   Structural genomics target

Details for d1wg1a_

PDB Entry: 1wg1

PDB Description: solution structure of rna binding domain in bab13405(homolog exc-7)

PDB Compounds: (A:) KIAA1579 protein

SCOP Domain Sequences for d1wg1a_:

Sequence; same for both SEQRES and ATOM records:

>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]}
gssgssgilvknlpqdsncqevhdllkdydlkycyvdrnkrtafvtllngeqaqnaiqmf
hqysfrgkdlivqlqptdallcsgpssg

Timeline for d1wg1a_:

• d1wg1a_ first appeared in SCOP 1.71
  
• d1wg1a_ appears in SCOP 1.75
  
• d1wg1a_ appears in the current release, SCOPe 2.08, called d1wg1a1