Lineage for d1wg1a_ (1wg1 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 603934Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 603935Family d.58.7.1: Canonical RBD [54929] (32 proteins)
  6. 604060Protein Probable RNA-binding protein KIAA1579 [117963] (1 species)
  7. 604061Species Human (Homo sapiens) [TaxId:9606] [117964] (1 PDB entry)
  8. 604062Domain d1wg1a_: 1wg1 A: [114599]
    Structural genomics target

Details for d1wg1a_

PDB Entry: 1wg1 (more details)

PDB Description: Solution structure of RNA binding domain in BAB13405(homolog EXC-7)

SCOP Domain Sequences for d1wg1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens)}
gssgssgilvknlpqdsncqevhdllkdydlkycyvdrnkrtafvtllngeqaqnaiqmf
hqysfrgkdlivqlqptdallcsgpssg

SCOP Domain Coordinates for d1wg1a_:

Click to download the PDB-style file with coordinates for d1wg1a_.
(The format of our PDB-style files is described here.)

Timeline for d1wg1a_: