Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
Protein Probable RNA-binding protein KIAA1579 [117963] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117964] (1 PDB entry) Uniprot Q9HCJ3 71-145 |
Domain d1wg1a1: 1wg1 A:97-171 [114599] Other proteins in same PDB: d1wg1a2, d1wg1a3 Structural genomics target |
PDB Entry: 1wg1 (more details)
SCOPe Domain Sequences for d1wg1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wg1a1 d.58.7.1 (A:97-171) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} ilvknlpqdsncqevhdllkdydlkycyvdrnkrtafvtllngeqaqnaiqmfhqysfrg kdlivqlqptdallc
Timeline for d1wg1a1: