Lineage for d1wfza1 (1wfz A:8-124)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2240027Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 2240028Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 2240053Family d.224.1.2: NifU/IscU domain [102928] (5 proteins)
  6. 2240054Protein Iron-sulfur cluster protein U (IscU) [117908] (1 species)
  7. 2240055Species Mouse (Mus musculus), mitochondrial [TaxId:10090] [117909] (1 PDB entry)
    Uniprot Q9D7P6 45-161
  8. 2240056Domain d1wfza1: 1wfz A:8-124 [114598]
    Other proteins in same PDB: d1wfza2, d1wfza3
    Structural genomics target
    complexed with zn

Details for d1wfza1

PDB Entry: 1wfz (more details)

PDB Description: solution structure of iron-sulfur cluster protein u (iscu)
PDB Compounds: (A:) nitrogen fixation cluster-like

SCOPe Domain Sequences for d1wfza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wfza1 d.224.1.2 (A:8-124) Iron-sulfur cluster protein U (IscU) {Mouse (Mus musculus), mitochondrial [TaxId: 10090]}
enprnvgsldktsknvgtglvgapacgdvmklqiqvdekgkivdarfktfgcgsaiasss
latewvkgktveealtikntdiakelclppvklhcsmlaedaikaaladyklkqesk

SCOPe Domain Coordinates for d1wfza1:

Click to download the PDB-style file with coordinates for d1wfza1.
(The format of our PDB-style files is described here.)

Timeline for d1wfza1: