Lineage for d1wfza_ (1wfz A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 616471Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 616472Superfamily d.224.1: SufE/NifU [82649] (2 families) (S)
    iron-sulfur cluster assembly proteins
  5. 616481Family d.224.1.2: NifU/IscU domain [102928] (4 proteins)
  6. 616482Protein Iron-sulfur cluster protein U (IscU) [117908] (1 species)
  7. 616483Species Mouse (Mus musculus), mitochondrial [TaxId:10090] [117909] (1 PDB entry)
  8. 616484Domain d1wfza_: 1wfz A: [114598]
    Structural genomics target
    complexed with zn

Details for d1wfza_

PDB Entry: 1wfz (more details)

PDB Description: solution structure of iron-sulfur cluster protein u (iscu)

SCOP Domain Sequences for d1wfza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wfza_ d.224.1.2 (A:) Iron-sulfur cluster protein U (IscU) {Mouse (Mus musculus), mitochondrial}
gssgssgenprnvgsldktsknvgtglvgapacgdvmklqiqvdekgkivdarfktfgcg
saiassslatewvkgktveealtikntdiakelclppvklhcsmlaedaikaaladyklk
qesksgpssg

SCOP Domain Coordinates for d1wfza_:

Click to download the PDB-style file with coordinates for d1wfza_.
(The format of our PDB-style files is described here.)

Timeline for d1wfza_: