Lineage for d1wfya_ (1wfy A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1892545Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1893599Family d.15.1.5: Ras-binding domain, RBD [54263] (14 protein domains)
    contains Pfam PF00788 and Pfam PF02196
  6. 1893713Protein Regulator of G-protein signaling 14, RGS14 [117821] (1 species)
  7. 1893714Species Mouse (Mus musculus) [TaxId:10090] [117822] (1 PDB entry)
    Uniprot P97492 366-456
  8. 1893715Domain d1wfya_: 1wfy A: [114597]
    Structural genomics target

Details for d1wfya_

PDB Entry: 1wfy (more details)

PDB Description: Solution structure of the Ras-binding domain of mouse RGS14
PDB Compounds: (A:) regulator of G-protein signaling 14; rap1/rap2 interacting protein

SCOPe Domain Sequences for d1wfya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wfya_ d.15.1.5 (A:) Regulator of G-protein signaling 14, RGS14 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgdqevrlenritfqlelvglervvrisakptkrlqealqpilakhglsldqvvl
hrpgekqpmdlenpvssvasqtlvldtppdakmsearssgpssg

SCOPe Domain Coordinates for d1wfya_:

Click to download the PDB-style file with coordinates for d1wfya_.
(The format of our PDB-style files is described here.)

Timeline for d1wfya_: