Lineage for d1wfxa_ (1wfx A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000428Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 3000429Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 3000718Family d.166.1.5: Tpt1/KptA [118162] (1 protein)
    Pfam PF01885; contains extra N-terminal domain similar to the "winged helix" DNA-binding domain (46785)
  6. 3000719Protein Probable RNA 2'-phosphotransferase KptA [118163] (1 species)
  7. 3000720Species Aeropyrum pernix [TaxId:56636] [118164] (1 PDB entry)
    Uniprot Q9YFP5 37-216; d1: (1-76); d2: (88-182)
  8. 3000721Domain d1wfxa_: 1wfx A: [114596]
    Structural genomics target
    complexed with cl, zn

Details for d1wfxa_

PDB Entry: 1wfx (more details), 2.8 Å

PDB Description: Crystal Structure of APE0204 from Aeropyrum pernix
PDB Compounds: (A:) Probable RNA 2'-phosphotransferase

SCOPe Domain Sequences for d1wfxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wfxa_ d.166.1.5 (A:) Probable RNA 2'-phosphotransferase KptA {Aeropyrum pernix [TaxId: 56636]}
vrlsktlagilrhhpgrygvrltregwarvsevveglrkagwswveewhivgvalhdpkg
ryelrngeiraryghsipvnveplpgepppilyhgtteealplimergimrgrrlkvhlt
ssledavstgrrhgnlvavllvdveclrrrglkvermsktvytvdwvppeciaevrresl

SCOPe Domain Coordinates for d1wfxa_:

Click to download the PDB-style file with coordinates for d1wfxa_.
(The format of our PDB-style files is described here.)

Timeline for d1wfxa_: