Lineage for d1wfva1 (1wfv A:8-97)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2379659Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2379660Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2379661Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2379762Protein Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) [101719] (1 species)
  7. 2379763Species Human (Homo sapiens) [TaxId:9606] [101720] (5 PDB entries)
    Uniprot Q86UL8 412-522, 600-682, 774-865, 913-1015, 1141-1230
  8. 2379768Domain d1wfva1: 1wfv A:8-97 [114594]
    Other proteins in same PDB: d1wfva2, d1wfva3
    Structural genomics target; 5th PDZ domain (of 6)

Details for d1wfva1

PDB Entry: 1wfv (more details)

PDB Description: Solution structure of the fifth PDZ domain of human membrane associated guanylate kinase inverted-2 (KIAA0705 protein)
PDB Compounds: (A:) membrane associated guanylate kinase inverted-2

SCOPe Domain Sequences for d1wfva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wfva1 b.36.1.1 (A:8-97) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]}
qdfdyftvdmekgakgfgfsirggreykmdlyvlrlaedgpairngrmrvgdqiieinge
strdmtharaieliksggrrvrlllkrgtg

SCOPe Domain Coordinates for d1wfva1:

Click to download the PDB-style file with coordinates for d1wfva1.
(The format of our PDB-style files is described here.)

Timeline for d1wfva1: