SCOPe 2.08: Domain d1wfva1: 1wfv A:8-97

Lineage for d1wfva1 (1wfv A:8-97)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) [101719] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101720] (5 PDB entries)
   Uniprot Q86UL8 412-522, 600-682, 774-865, 913-1015, 1141-1230

8. Domain d1wfva1: 1wfv A:8-97 [114594]
   Other proteins in same PDB: d1wfva2, d1wfva3
   Structural genomics target; 5th PDZ domain (of 6)

Details for d1wfva1

PDB Entry: 1wfv

PDB Description: solution structure of the fifth pdz domain of human membrane associated guanylate kinase inverted-2 (kiaa0705 protein)

PDB Compounds: (A:) membrane associated guanylate kinase inverted-2

SCOPe Domain Sequences for d1wfva1:

Sequence; same for both SEQRES and ATOM records:

>d1wfva1 b.36.1.1 (A:8-97) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]}
qdfdyftvdmekgakgfgfsirggreykmdlyvlrlaedgpairngrmrvgdqiieinge
strdmtharaieliksggrrvrlllkrgtg

Timeline for d1wfva1:

• d1wfva1 first appeared in SCOP 1.71, called d1wfva_
  
• d1wfva1 appears in SCOPe 2.07