Lineage for d1wfua_ (1wfu A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 550820Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 550821Family b.1.2.1: Fibronectin type III [49266] (28 proteins)
    Pfam 00041
  6. 550910Protein Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 [117053] (1 species)
  7. 550911Species Mouse (Mus musculus) [TaxId:10090] [117054] (1 PDB entry)
  8. 550912Domain d1wfua_: 1wfu A: [114593]

Details for d1wfua_

PDB Entry: 1wfu (more details)

PDB Description: Solution structure of fibronectin type III domain of mouse hypothetical protein

SCOP Domain Sequences for d1wfua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus)}
gssgssgmephkvvplskphppvvgkvthhsielywdleqkekrqgpqeqwlrfsieeed
pkmhsygviytgyatrhvvegleprtlykfrlkvtspsgeyeyspvvsvattresgpssg

SCOP Domain Coordinates for d1wfua_:

Click to download the PDB-style file with coordinates for d1wfua_.
(The format of our PDB-style files is described here.)

Timeline for d1wfua_: