SCOPe 2.08: Domain d1wfua1: 1wfu A:8-114

Lineage for d1wfua1 (1wfu A:8-114)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 [117053] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117054] (1 PDB entry)
   Uniprot Q9DAM9 1-107

8. Domain d1wfua1: 1wfu A:8-114 [114593]
   Other proteins in same PDB: d1wfua2, d1wfua3

Details for d1wfua1

PDB Entry: 1wfu

PDB Description: solution structure of fibronectin type iii domain of mouse hypothetical protein

PDB Compounds: (A:) unnamed protein product

SCOPe Domain Sequences for d1wfua1:

Sequence; same for both SEQRES and ATOM records:

>d1wfua1 b.1.2.1 (A:8-114) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]}
mephkvvplskphppvvgkvthhsielywdleqkekrqgpqeqwlrfsieeedpkmhsyg
viytgyatrhvvegleprtlykfrlkvtspsgeyeyspvvsvattre

Timeline for d1wfua1:

• d1wfua1 first appeared in SCOP 1.71, called d1wfua_
  
• d1wfua1 appears in SCOPe 2.07