Lineage for d1wfta_ (1wft A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 550820Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 550821Family b.1.2.1: Fibronectin type III [49266] (28 proteins)
    Pfam 00041
  6. 550980Protein Host cell factor 2, HCF-2 [117051] (1 species)
  7. 550981Species Mouse (Mus musculus) [TaxId:10090] [117052] (1 PDB entry)
  8. 550982Domain d1wfta_: 1wft A: [114592]
    Structural genomics target; 2nd FnIII domain (of 2)

Details for d1wfta_

PDB Entry: 1wft (more details)

PDB Description: Solution structure of C-terminal fibronectin type III domain of mouse 1700129L13Rik protein

SCOP Domain Sequences for d1wfta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus)}
gssgssgpgapstvrisknvdgihlswepptspsgnileysaylairtaqmqdnpsqlvf
mriycglktsctvtagqlanahidytsrpaivfrisaknekgygpatqirwlqgnsksgp
ssg

SCOP Domain Coordinates for d1wfta_:

Click to download the PDB-style file with coordinates for d1wfta_.
(The format of our PDB-style files is described here.)

Timeline for d1wfta_: