Lineage for d1wfsa1 (1wfs A:2-145)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2534201Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2534202Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2534346Family d.109.1.2: Cofilin-like [55762] (8 proteins)
  6. 2534392Protein Glia maturation factor gamma, GMF-gamma [111110] (2 species)
  7. 2534396Species Mouse (Mus musculus) [TaxId:10090] [111111] (2 PDB entries)
    Uniprot Q9ERL7
  8. 2534398Domain d1wfsa1: 1wfs A:2-145 [114591]
    Other proteins in same PDB: d1wfsa2, d1wfsa3
    Structural genomics target

Details for d1wfsa1

PDB Entry: 1wfs (more details)

PDB Description: Solution Structure of Glia Maturation Factor-gamma from Mus Musculus
PDB Compounds: (A:) Glia maturation factor gamma

SCOPe Domain Sequences for d1wfsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wfsa1 d.109.1.2 (A:2-145) Glia maturation factor gamma, GMF-gamma {Mouse (Mus musculus) [TaxId: 10090]}
ssgssgsdslvvcevdpelketlrkfrfrketnnaaiimkvdkdrqmvvledelqnispe
elklelperqprfvvysykyvhddgrvsyplcfifsspvgckpeqqmmyagsknrlvqta
eltkvfeirttddltetwlkekla

SCOPe Domain Coordinates for d1wfsa1:

Click to download the PDB-style file with coordinates for d1wfsa1.
(The format of our PDB-style files is described here.)

Timeline for d1wfsa1: