Lineage for d1wfra_ (1wfr A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1426777Fold d.106: SCP-like [55717] (1 superfamily)
    alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145
  4. 1426778Superfamily d.106.1: SCP-like [55718] (5 families) (S)
  5. 1426779Family d.106.1.1: Sterol carrier protein, SCP [55719] (4 proteins)
    Pfam PF02036
  6. 1426780Protein Hypothetical protein TT1886 (TTHA0401) [118060] (1 species)
  7. 1426781Species Thermus thermophilus [TaxId:274] [118061] (1 PDB entry)
    Uniprot Q5SL92
  8. 1426782Domain d1wfra_: 1wfr A: [114590]
    Structural genomics target

Details for d1wfra_

PDB Entry: 1wfr (more details)

PDB Description: Solution structure of the conserved hypothetical protein TT1886, possibly sterol carrier protein, from Thermus Thermophilus HB8
PDB Compounds: (A:) Hypothetical Protein TT1886

SCOPe Domain Sequences for d1wfra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wfra_ d.106.1.1 (A:) Hypothetical protein TT1886 (TTHA0401) {Thermus thermophilus [TaxId: 274]}
gssgssgmelfteawaqaycrklneseayrkaastwegslalavrpdpkagfpkgvavvl
dlwhgacrgakavegeaeadfvieadlatwqevlegrleplsalmrgllelkkgtiaala
pyaqaaqelvkvarevasgpssg

SCOPe Domain Coordinates for d1wfra_:

Click to download the PDB-style file with coordinates for d1wfra_.
(The format of our PDB-style files is described here.)

Timeline for d1wfra_: