![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.106: SCP-like [55717] (1 superfamily) alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145 |
![]() | Superfamily d.106.1: SCP-like [55718] (4 families) ![]() |
![]() | Family d.106.1.1: Sterol carrier protein, SCP [55719] (3 proteins) Pfam PF02036 |
![]() | Protein Hypothetical protein TT1886 (TTHA0401) [118060] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [118061] (1 PDB entry) Uniprot Q5SL92 |
![]() | Domain d1wfra_: 1wfr A: [114590] Structural genomics target |
PDB Entry: 1wfr (more details)
SCOP Domain Sequences for d1wfra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wfra_ d.106.1.1 (A:) Hypothetical protein TT1886 (TTHA0401) {Thermus thermophilus [TaxId: 274]} gssgssgmelfteawaqaycrklneseayrkaastwegslalavrpdpkagfpkgvavvl dlwhgacrgakavegeaeadfvieadlatwqevlegrleplsalmrgllelkkgtiaala pyaqaaqelvkvarevasgpssg
Timeline for d1wfra_: