SCOP 1.75: Domain d1wfra_: 1wfr A:

Lineage for d1wfra_ (1wfr A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.106: SCP-like [55717] (1 superfamily)
   alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145

4. Superfamily d.106.1: SCP-like [55718] (4 families)

5. Family d.106.1.1: Sterol carrier protein, SCP [55719] (3 proteins)
   Pfam PF02036

6. Protein Hypothetical protein TT1886 (TTHA0401) [118060] (1 species)

7. Species Thermus thermophilus [TaxId:274] [118061] (1 PDB entry)
   Uniprot Q5SL92

8. Domain d1wfra_: 1wfr A: [114590]
   Structural genomics target

Details for d1wfra_

PDB Entry: 1wfr

PDB Description: Solution structure of the conserved hypothetical protein TT1886, possibly sterol carrier protein, from Thermus Thermophilus HB8

PDB Compounds: (A:) Hypothetical Protein TT1886

SCOP Domain Sequences for d1wfra_:

Sequence; same for both SEQRES and ATOM records:

>d1wfra_ d.106.1.1 (A:) Hypothetical protein TT1886 (TTHA0401) {Thermus thermophilus [TaxId: 274]}
gssgssgmelfteawaqaycrklneseayrkaastwegslalavrpdpkagfpkgvavvl
dlwhgacrgakavegeaeadfvieadlatwqevlegrleplsalmrgllelkkgtiaala
pyaqaaqelvkvarevasgpssg

Timeline for d1wfra_:

• d1wfra_ first appeared in SCOP 1.71
  
• d1wfra_ appears in SCOP 1.73
  
• d1wfra_ appears in SCOPe 2.01
  
• d1wfra_ appears in the current release, SCOPe 2.08, called d1wfra1