Lineage for d1wfra_ (1wfr A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730949Fold d.106: Sterol carrier protein, SCP [55717] (1 superfamily)
    alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145
  4. 730950Superfamily d.106.1: Sterol carrier protein, SCP [55718] (1 family) (S)
  5. 730951Family d.106.1.1: Sterol carrier protein, SCP [55719] (3 proteins)
    Pfam PF02036
  6. 730952Protein Hypothetical protein TT1886 (TTHA0401) [118060] (1 species)
  7. 730953Species Thermus thermophilus [TaxId:274] [118061] (1 PDB entry)
  8. 730954Domain d1wfra_: 1wfr A: [114590]
    Structural genomics target

Details for d1wfra_

PDB Entry: 1wfr (more details)

PDB Description: Solution structure of the conserved hypothetical protein TT1886, possibly sterol carrier protein, from Thermus Thermophilus HB8
PDB Compounds: (A:) Hypothetical Protein TT1886

SCOP Domain Sequences for d1wfra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wfra_ d.106.1.1 (A:) Hypothetical protein TT1886 (TTHA0401) {Thermus thermophilus [TaxId: 274]}
gssgssgmelfteawaqaycrklneseayrkaastwegslalavrpdpkagfpkgvavvl
dlwhgacrgakavegeaeadfvieadlatwqevlegrleplsalmrgllelkkgtiaala
pyaqaaqelvkvarevasgpssg

SCOP Domain Coordinates for d1wfra_:

Click to download the PDB-style file with coordinates for d1wfra_.
(The format of our PDB-style files is described here.)

Timeline for d1wfra_: