Lineage for d1wfqa_ (1wfq A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 668013Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) (S)
  5. 668307Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins)
    barrel, closed; n=5, S=8
  6. 668346Protein Cold shock domain protein E1 (UNR) [117198] (1 species)
  7. 668347Species Human (Homo sapiens) [TaxId:9606] [117199] (1 PDB entry)
  8. 668348Domain d1wfqa_: 1wfq A: [114589]
    Structural genomics target; 1st CSD (of 9)

Details for d1wfqa_

PDB Entry: 1wfq (more details)

PDB Description: Solution structure of the first cold-shock domain of the human KIAA0885 protein (UNR protein)
PDB Compounds: (A:) UNR protein

SCOP Domain Sequences for d1wfqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wfqa_ b.40.4.5 (A:) Cold shock domain protein E1 (UNR) {Human (Homo sapiens) [TaxId: 9606]}
gssgssggypngtsaalretgvieklltsygfiqcserqarlffhcsqyngnlqdlkvgd
dvefevssdrrtgkpiavklvkisgpssg

SCOP Domain Coordinates for d1wfqa_:

Click to download the PDB-style file with coordinates for d1wfqa_.
(The format of our PDB-style files is described here.)

Timeline for d1wfqa_: