SCOPe 2.06: Domain d1wfpa1: 1wfp A:8-68

Lineage for d1wfpa1 (1wfp A:8-68)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.80: AN1-like Zinc finger [118309] (1 superfamily)
   dimetal(zinc)-bound alpha+beta fold; partial similarity to the Cysteine-rich domain fold (57888)

4. Superfamily g.80.1: AN1-like Zinc finger [118310] (1 family)

5. Family g.80.1.1: AN1-like Zinc finger [118311] (6 proteins)
   Pfam PF01428

6. Protein Zinc finger A20 and AN1 domains containing protein At1g12440 [118320] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118321] (1 PDB entry)
   Uniprot Q6NNI8 89-149

8. Domain d1wfpa1: 1wfp A:8-68 [114588]
   Other proteins in same PDB: d1wfpa2, d1wfpa3
   Structural genomics target
   complexed with zn

Details for d1wfpa1

PDB Entry: 1wfp

PDB Description: solution structure of the zf-an1 domain from arabiopsis thaliana f5o11.17 protein

PDB Compounds: (A:) zinc finger (AN1-like) family protein

SCOPe Domain Sequences for d1wfpa1:

Sequence; same for both SEQRES and ATOM records:

>d1wfpa1 g.80.1.1 (A:8-68) Zinc finger A20 and AN1 domains containing protein At1g12440 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
trggdsaaapldppkstatrclscnkkvgvtgfkcrcgstfcgthrypeshecqfdfkgv
a

Timeline for d1wfpa1:

• d1wfpa1 first appeared in SCOP 1.71, called d1wfpa_
  
• d1wfpa1 was called d1wfpa_ in SCOPe 2.05
  
• d1wfpa1 appears in SCOPe 2.07
  
• d1wfpa1 appears in the current release, SCOPe 2.08