Lineage for d1wfpa_ (1wfp A:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 625707Fold g.80: AN1-like Zinc finger [118309] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold; partial similarity to the Cysteine-rich domain fold (scop_cf 57888)
  4. 625708Superfamily g.80.1: AN1-like Zinc finger [118310] (1 family) (S)
  5. 625709Family g.80.1.1: AN1-like Zinc finger [118311] (6 proteins)
    Pfam 01428
  6. 625719Protein Zinc finger A20 and AN1 domains containing protein At1g12440 [118320] (1 species)
  7. 625720Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118321] (1 PDB entry)
  8. 625721Domain d1wfpa_: 1wfp A: [114588]
    Structural genomics target
    complexed with zn

Details for d1wfpa_

PDB Entry: 1wfp (more details)

PDB Description: solution structure of the zf-an1 domain from arabiopsis thaliana f5o11.17 protein

SCOP Domain Sequences for d1wfpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wfpa_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At1g12440 {Thale cress (Arabidopsis thaliana)}
gssgssgtrggdsaaapldppkstatrclscnkkvgvtgfkcrcgstfcgthrypeshec
qfdfkgvasgpssg

SCOP Domain Coordinates for d1wfpa_:

Click to download the PDB-style file with coordinates for d1wfpa_.
(The format of our PDB-style files is described here.)

Timeline for d1wfpa_: