Lineage for d1wfpa1 (1wfp A:8-68)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038716Fold g.80: AN1-like Zinc finger [118309] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold; partial similarity to the Cysteine-rich domain fold (57888)
  4. 3038717Superfamily g.80.1: AN1-like Zinc finger [118310] (1 family) (S)
  5. 3038718Family g.80.1.1: AN1-like Zinc finger [118311] (6 proteins)
    Pfam PF01428
  6. 3038728Protein Zinc finger A20 and AN1 domains containing protein At1g12440 [118320] (1 species)
  7. 3038729Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118321] (1 PDB entry)
    Uniprot Q6NNI8 89-149
  8. 3038730Domain d1wfpa1: 1wfp A:8-68 [114588]
    Other proteins in same PDB: d1wfpa2, d1wfpa3
    Structural genomics target
    complexed with zn

Details for d1wfpa1

PDB Entry: 1wfp (more details)

PDB Description: solution structure of the zf-an1 domain from arabiopsis thaliana f5o11.17 protein
PDB Compounds: (A:) zinc finger (AN1-like) family protein

SCOPe Domain Sequences for d1wfpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wfpa1 g.80.1.1 (A:8-68) Zinc finger A20 and AN1 domains containing protein At1g12440 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
trggdsaaapldppkstatrclscnkkvgvtgfkcrcgstfcgthrypeshecqfdfkgv
a

SCOPe Domain Coordinates for d1wfpa1:

Click to download the PDB-style file with coordinates for d1wfpa1.
(The format of our PDB-style files is described here.)

Timeline for d1wfpa1: