SCOPe 2.05: Domain d1wfma_: 1wfm A:

Lineage for d1wfma_ (1wfm A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families)
   two constituent families are related by circular permutation

5. Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
   topologically similar to the C-terminal domain of PapD

6. Protein Synaptotagmin XIII [117084] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117085] (1 PDB entry)
   Uniprot Q7L8C5 155-280

8. Domain d1wfma_: 1wfm A: [114587]
   Structural genomics target; 1st C2 domain (of 2)

Details for d1wfma_

PDB Entry: 1wfm

PDB Description: the first c2 domain of human synaptotagmin xiii

PDB Compounds: (A:) synaptotagmin XIII

SCOPe Domain Sequences for d1wfma_:

Sequence; same for both SEQRES and ATOM records:

>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]}
gssgssgswnqapklhycldydcqkaelfvtrleavtsnhdggcdcyvqgsvanrtgsve
aqtalkkrqlhttweeglvlplaeeelptatltltlrtcdrfsrhsvagelrlgldgtsv
plgaaqwgelktsgpssg

Timeline for d1wfma_:

• d1wfma_ first appeared in SCOP 1.71
  
• d1wfma_ appears in SCOPe 2.04
  
• d1wfma_ is called d1wfma1 in SCOPe 2.06
  
• d1wfma_ appears in the current release, SCOPe 2.08, called d1wfma1