![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.80: AN1-like Zinc finger [118309] (1 superfamily) dimetal(zinc)-bound alpha+beta fold; partial similarity to the Cysteine-rich domain fold (57888) |
![]() | Superfamily g.80.1: AN1-like Zinc finger [118310] (1 family) ![]() |
![]() | Family g.80.1.1: AN1-like Zinc finger [118311] (6 proteins) Pfam PF01428 |
![]() | Protein Zinc finger A20 domain containing protein 2 [118318] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [118319] (1 PDB entry) Uniprot O88878 134-194 |
![]() | Domain d1wfla1: 1wfl A:8-68 [114586] Other proteins in same PDB: d1wfla2, d1wfla3 Structural genomics target complexed with zn |
PDB Entry: 1wfl (more details)
SCOPe Domain Sequences for d1wfla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wfla1 g.80.1.1 (A:8-68) Zinc finger A20 domain containing protein 2 {Mouse (Mus musculus) [TaxId: 10090]} psssqseekapelpkpkknrcfmcrkkvgltgfdcrcgnlfcglhrysdkhncpydykae a
Timeline for d1wfla1: