Lineage for d1wfla1 (1wfl A:8-68)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038716Fold g.80: AN1-like Zinc finger [118309] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold; partial similarity to the Cysteine-rich domain fold (57888)
  4. 3038717Superfamily g.80.1: AN1-like Zinc finger [118310] (1 family) (S)
  5. 3038718Family g.80.1.1: AN1-like Zinc finger [118311] (6 proteins)
    Pfam PF01428
  6. 3038734Protein Zinc finger A20 domain containing protein 2 [118318] (1 species)
  7. 3038735Species Mouse (Mus musculus) [TaxId:10090] [118319] (1 PDB entry)
    Uniprot O88878 134-194
  8. 3038736Domain d1wfla1: 1wfl A:8-68 [114586]
    Other proteins in same PDB: d1wfla2, d1wfla3
    Structural genomics target
    complexed with zn

Details for d1wfla1

PDB Entry: 1wfl (more details)

PDB Description: solution structure of the zf-an1 domain from mouse zinc finger protein 216
PDB Compounds: (A:) Zinc finger protein 216

SCOPe Domain Sequences for d1wfla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wfla1 g.80.1.1 (A:8-68) Zinc finger A20 domain containing protein 2 {Mouse (Mus musculus) [TaxId: 10090]}
psssqseekapelpkpkknrcfmcrkkvgltgfdcrcgnlfcglhrysdkhncpydykae
a

SCOPe Domain Coordinates for d1wfla1:

Click to download the PDB-style file with coordinates for d1wfla1.
(The format of our PDB-style files is described here.)

Timeline for d1wfla1: