![]() | Class g: Small proteins [56992] (79 folds) |
![]() | Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily) dimetal(zinc)-bound alpha+beta fold |
![]() | Superfamily g.50.1: FYVE/PHD zinc finger [57903] (3 families) ![]() |
![]() | Family g.50.1.1: FYVE, a phosphatidylinositol-3-phosphate binding domain [57904] (6 proteins) |
![]() | Protein Zinc finger FYVE domain containing protein 19 [118324] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [118325] (1 PDB entry) |
![]() | Domain d1wfka_: 1wfk A: [114585] Structural genomics target complexed with zn |
PDB Entry: 1wfk (more details)
SCOP Domain Sequences for d1wfka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wfka_ g.50.1.1 (A:) Zinc finger FYVE domain containing protein 19 {Mouse (Mus musculus)} gssgssgmesrcygcavkftlfkkeygckncgrafcngclsfsalvpragntqqkvckqc htiltrgssdnaskwsppqnyksgpssg
Timeline for d1wfka_: