Lineage for d1wfka_ (1wfk A:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 625240Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 625241Superfamily g.50.1: FYVE/PHD zinc finger [57903] (3 families) (S)
  5. 625242Family g.50.1.1: FYVE, a phosphatidylinositol-3-phosphate binding domain [57904] (6 proteins)
  6. 625261Protein Zinc finger FYVE domain containing protein 19 [118324] (1 species)
  7. 625262Species Mouse (Mus musculus) [TaxId:10090] [118325] (1 PDB entry)
  8. 625263Domain d1wfka_: 1wfk A: [114585]
    Structural genomics target
    complexed with zn

Details for d1wfka_

PDB Entry: 1wfk (more details)

PDB Description: fyve domain of fyve domain containing 19 protein from mus musculus

SCOP Domain Sequences for d1wfka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wfka_ g.50.1.1 (A:) Zinc finger FYVE domain containing protein 19 {Mouse (Mus musculus)}
gssgssgmesrcygcavkftlfkkeygckncgrafcngclsfsalvpragntqqkvckqc
htiltrgssdnaskwsppqnyksgpssg

SCOP Domain Coordinates for d1wfka_:

Click to download the PDB-style file with coordinates for d1wfka_.
(The format of our PDB-style files is described here.)

Timeline for d1wfka_: