![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies) dimetal(zinc)-bound alpha+beta fold |
![]() | Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) ![]() |
![]() | Family g.50.1.1: FYVE, a phosphatidylinositol-3-phosphate binding domain [57904] (6 proteins) |
![]() | Protein Zinc finger FYVE domain containing protein 19 [118324] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [118325] (1 PDB entry) Uniprot Q9DAZ9 1-75 |
![]() | Domain d1wfka1: 1wfk A:8-82 [114585] Other proteins in same PDB: d1wfka2, d1wfka3 Structural genomics target complexed with zn |
PDB Entry: 1wfk (more details)
SCOPe Domain Sequences for d1wfka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wfka1 g.50.1.1 (A:8-82) Zinc finger FYVE domain containing protein 19 {Mouse (Mus musculus) [TaxId: 10090]} mesrcygcavkftlfkkeygckncgrafcngclsfsalvpragntqqkvckqchtiltrg ssdnaskwsppqnyk
Timeline for d1wfka1: