Lineage for d1wfka1 (1wfk A:8-82)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037862Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
    dimetal(zinc)-bound alpha+beta fold
  4. 3037863Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 3037864Family g.50.1.1: FYVE, a phosphatidylinositol-3-phosphate binding domain [57904] (6 proteins)
  6. 3037883Protein Zinc finger FYVE domain containing protein 19 [118324] (1 species)
  7. 3037884Species Mouse (Mus musculus) [TaxId:10090] [118325] (1 PDB entry)
    Uniprot Q9DAZ9 1-75
  8. 3037885Domain d1wfka1: 1wfk A:8-82 [114585]
    Other proteins in same PDB: d1wfka2, d1wfka3
    Structural genomics target
    complexed with zn

Details for d1wfka1

PDB Entry: 1wfk (more details)

PDB Description: fyve domain of fyve domain containing 19 protein from mus musculus
PDB Compounds: (A:) zinc finger, FYVE domain containing 19

SCOPe Domain Sequences for d1wfka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wfka1 g.50.1.1 (A:8-82) Zinc finger FYVE domain containing protein 19 {Mouse (Mus musculus) [TaxId: 10090]}
mesrcygcavkftlfkkeygckncgrafcngclsfsalvpragntqqkvckqchtiltrg
ssdnaskwsppqnyk

SCOPe Domain Coordinates for d1wfka1:

Click to download the PDB-style file with coordinates for d1wfka1.
(The format of our PDB-style files is described here.)

Timeline for d1wfka1: