SCOPe 2.07: Domain d1wfja1: 1wfj A:8-130

Lineage for d1wfja1 (1wfj A:8-130)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families)
   two constituent families are related by circular permutation

5. Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
   topologically similar to the C-terminal domain of PapD

6. Protein C2 domain protein At1g63220 [117082] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117083] (1 PDB entry)
   Uniprot Q9C8S6 2-125

8. Domain d1wfja1: 1wfj A:8-130 [114584]
   Other proteins in same PDB: d1wfja2, d1wfja3
   Structural genomics target

Details for d1wfja1

PDB Entry: 1wfj

PDB Description: c2 domain-containing protein from putative elicitor-responsive gene

PDB Compounds: (A:) putative elicitor-responsive gene

SCOPe Domain Sequences for d1wfja1:

Sequence; same for both SEQRES and ATOM records:

>d1wfja1 b.7.1.2 (A:8-130) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
phgtlevvlvsakgledadflnnmdpyvqltcrtqdqksnvaegmgttpewnetfiftvs
egttelkakifdkdvgteddavgeatiplepvfvegsipptaynvvkdeeykgeiwvals
fkp

Timeline for d1wfja1:

• d1wfja1 first appeared in SCOP 1.71, called d1wfja_
  
• d1wfja1 appears in SCOPe 2.06
  
• d1wfja1 appears in the current release, SCOPe 2.08