SCOP 1.73: Domain d1wfja_: 1wfj A:

Lineage for d1wfja_ (1wfj A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.7: C2 domain-like [49561] (4 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families)
   two constituent families are related by circular permutation

5. Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (10 proteins)
   topologically similar to the C-terminal domain of PapD

6. Protein C2 domain protein At1g63220 [117082] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117083] (1 PDB entry)

8. Domain d1wfja_: 1wfj A: [114584]
   Structural genomics target

Details for d1wfja_

PDB Entry: 1wfj

PDB Description: c2 domain-containing protein from putative elicitor-responsive gene

PDB Compounds: (A:) putative elicitor-responsive gene

SCOP Domain Sequences for d1wfja_:

Sequence; same for both SEQRES and ATOM records:

>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gssgssgphgtlevvlvsakgledadflnnmdpyvqltcrtqdqksnvaegmgttpewne
tfiftvsegttelkakifdkdvgteddavgeatiplepvfvegsipptaynvvkdeeykg
eiwvalsfkpsgpssg

Timeline for d1wfja_:

• d1wfja_ first appeared in SCOP 1.71
  
• d1wfja_ appears in SCOP 1.75
  
• d1wfja_ appears in the current release, SCOPe 2.08, called d1wfja1