![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.7: C2 domain-like [49561] (4 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) ![]() two constituent families are related by circular permutation |
![]() | Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (10 proteins) topologically similar to the C-terminal domain of PapD |
![]() | Protein C2 domain protein At1g63220 [117082] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117083] (1 PDB entry) |
![]() | Domain d1wfja_: 1wfj A: [114584] Structural genomics target |
PDB Entry: 1wfj (more details)
SCOP Domain Sequences for d1wfja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} gssgssgphgtlevvlvsakgledadflnnmdpyvqltcrtqdqksnvaegmgttpewne tfiftvsegttelkakifdkdvgteddavgeatiplepvfvegsipptaynvvkdeeykg eiwvalsfkpsgpssg
Timeline for d1wfja_: