Lineage for d1wfja_ (1wfj A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 554333Fold b.7: C2 domain-like [49561] (4 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 554334Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) (S)
    two constituent families are related by circular permutation
  5. 554385Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (10 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 554393Protein C2 domain protein At1g63220 [117082] (1 species)
  7. 554394Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117083] (1 PDB entry)
  8. 554395Domain d1wfja_: 1wfj A: [114584]
    Structural genomics target

Details for d1wfja_

PDB Entry: 1wfj (more details)

PDB Description: c2 domain-containing protein from putative elicitor-responsive gene

SCOP Domain Sequences for d1wfja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana)}
gssgssgphgtlevvlvsakgledadflnnmdpyvqltcrtqdqksnvaegmgttpewne
tfiftvsegttelkakifdkdvgteddavgeatiplepvfvegsipptaynvvkdeeykg
eiwvalsfkpsgpssg

SCOP Domain Coordinates for d1wfja_:

Click to download the PDB-style file with coordinates for d1wfja_.
(The format of our PDB-style files is described here.)

Timeline for d1wfja_: