Lineage for d1wfja1 (1wfj A:8-130)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2772795Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. 2772956Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 2772970Protein C2 domain protein At1g63220 [117082] (1 species)
  7. 2772971Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [117083] (1 PDB entry)
    Uniprot Q9C8S6 2-125
  8. 2772972Domain d1wfja1: 1wfj A:8-130 [114584]
    Other proteins in same PDB: d1wfja2, d1wfja3
    Structural genomics target

Details for d1wfja1

PDB Entry: 1wfj (more details)

PDB Description: c2 domain-containing protein from putative elicitor-responsive gene
PDB Compounds: (A:) putative elicitor-responsive gene

SCOPe Domain Sequences for d1wfja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wfja1 b.7.1.2 (A:8-130) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
phgtlevvlvsakgledadflnnmdpyvqltcrtqdqksnvaegmgttpewnetfiftvs
egttelkakifdkdvgteddavgeatiplepvfvegsipptaynvvkdeeykgeiwvals
fkp

SCOPe Domain Coordinates for d1wfja1:

Click to download the PDB-style file with coordinates for d1wfja1.
(The format of our PDB-style files is described here.)

Timeline for d1wfja1: