Lineage for d1wfia1 (1wfi A:8-125)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383524Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2383525Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) (S)
  5. 2383620Family b.15.1.4: Nuclear movement domain [117092] (2 proteins)
    Pfam PF03593
  6. 2383621Protein Nuclear migration protein nudC [117093] (1 species)
  7. 2383622Species Mouse (Mus musculus) [TaxId:10090] [117094] (2 PDB entries)
    Uniprot O35685 171-288
  8. 2383624Domain d1wfia1: 1wfi A:8-125 [114583]
    Other proteins in same PDB: d1wfia2, d1wfia3
    Structural genomics target

Details for d1wfia1

PDB Entry: 1wfi (more details)

PDB Description: nuclear move domain of nuclear distribution gene c homolog
PDB Compounds: (A:) nuclear distribution gene C homolog

SCOPe Domain Sequences for d1wfia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wfia1 b.15.1.4 (A:8-125) Nuclear migration protein nudC {Mouse (Mus musculus) [TaxId: 10090]}
pnyrwtqtlaeldlavpfrvsfrlkgkdvvvdiqrrhlrvglkgqppvvdgelynevkve
esswliedgkvvtvhlekinkmewwnrlvtsdpeintkkinpensklsdldsetrsmv

SCOPe Domain Coordinates for d1wfia1:

Click to download the PDB-style file with coordinates for d1wfia1.
(The format of our PDB-style files is described here.)

Timeline for d1wfia1: