SCOPe 2.05: Domain d1wfia_: 1wfi A:

Lineage for d1wfia_ (1wfi A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.15.1: HSP20-like chaperones [49764] (5 families)

5. Family b.15.1.4: Nuclear movement domain [117092] (2 proteins)
   Pfam PF03593

6. Protein Nuclear migration protein nudC [117093] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117094] (2 PDB entries)
   Uniprot O35685 171-288

8. Domain d1wfia_: 1wfi A: [114583]
   Structural genomics target

Details for d1wfia_

PDB Entry: 1wfi

PDB Description: nuclear move domain of nuclear distribution gene c homolog

PDB Compounds: (A:) nuclear distribution gene C homolog

SCOPe Domain Sequences for d1wfia_:

Sequence; same for both SEQRES and ATOM records:

>d1wfia_ b.15.1.4 (A:) Nuclear migration protein nudC {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgpnyrwtqtlaeldlavpfrvsfrlkgkdvvvdiqrrhlrvglkgqppvvdgel
ynevkveesswliedgkvvtvhlekinkmewwnrlvtsdpeintkkinpensklsdldse
trsmvsgpssg

Timeline for d1wfia_:

• d1wfia_ first appeared in SCOP 1.71
  
• d1wfia_ appears in SCOPe 2.04
  
• d1wfia_ is called d1wfia1 in SCOPe 2.06
  
• d1wfia_ appears in the current release, SCOPe 2.08, called d1wfia1