Lineage for d1wfia_ (1wfi A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 554752Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 554753Superfamily b.15.1: HSP20-like chaperones [49764] (4 families) (S)
  5. 554785Family b.15.1.4: Nuclear movement domain [117092] (2 proteins)
    Pfam 03593
  6. 554786Protein Nuclear migration protein nudC [117093] (1 species)
  7. 554787Species Mouse (Mus musculus) [TaxId:10090] [117094] (1 PDB entry)
  8. 554788Domain d1wfia_: 1wfi A: [114583]
    Structural genomics target

Details for d1wfia_

PDB Entry: 1wfi (more details)

PDB Description: nuclear move domain of nuclear distribution gene c homolog

SCOP Domain Sequences for d1wfia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wfia_ b.15.1.4 (A:) Nuclear migration protein nudC {Mouse (Mus musculus)}
gssgssgpnyrwtqtlaeldlavpfrvsfrlkgkdvvvdiqrrhlrvglkgqppvvdgel
ynevkveesswliedgkvvtvhlekinkmewwnrlvtsdpeintkkinpensklsdldse
trsmvsgpssg

SCOP Domain Coordinates for d1wfia_:

Click to download the PDB-style file with coordinates for d1wfia_.
(The format of our PDB-style files is described here.)

Timeline for d1wfia_: