Lineage for d1wfga_ (1wfg A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 948106Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 948107Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 948108Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 948142Protein DNA Regulating synaptic membrane exocytosis protein 2, RIMS2 [117176] (1 species)
  7. 948143Species Human (Homo sapiens) [TaxId:9606] [117177] (1 PDB entry)
    Uniprot Q9UQ26 637-754; the structure of the 1st C2 domain (807-934) is also known (101565)
  8. 948144Domain d1wfga_: 1wfg A: [114581]
    Structural genomics target

Details for d1wfga_

PDB Entry: 1wfg (more details)

PDB Description: pdz domain of human rim2b
PDB Compounds: (A:) Regulating synaptic membrane exocytosis protein 2

SCOPe Domain Sequences for d1wfga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wfga_ b.36.1.1 (A:) DNA Regulating synaptic membrane exocytosis protein 2, RIMS2 {Human (Homo sapiens) [TaxId: 9606]}
gssgssghshsdkhpvtwqpskdgdrligrillnkrlkdgsvprdsgamlglkvvggkmt
esgrlcafitkvkkgsladtvghlrpgdevlewngrllqgatfeevyniileskpepqve
lvvsrsgpssg

SCOPe Domain Coordinates for d1wfga_:

Click to download the PDB-style file with coordinates for d1wfga_.
(The format of our PDB-style files is described here.)

Timeline for d1wfga_: