Lineage for d1wffa1 (1wff A:8-79)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2643382Fold g.80: AN1-like Zinc finger [118309] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold; partial similarity to the Cysteine-rich domain fold (57888)
  4. 2643383Superfamily g.80.1: AN1-like Zinc finger [118310] (1 family) (S)
  5. 2643384Family g.80.1.1: AN1-like Zinc finger [118311] (6 proteins)
    Pfam PF01428
  6. 2643388Protein ANUBL1 (AN1, ubiquitin-like, homolog) [118314] (1 species)
  7. 2643389Species Mouse (Mus musculus) [TaxId:10090] [118315] (1 PDB entry)
    Uniprot Q86XD8 732-802
  8. 2643390Domain d1wffa1: 1wff A:8-79 [114580]
    Other proteins in same PDB: d1wffa2, d1wffa3
    Structural genomics target
    complexed with zn

Details for d1wffa1

PDB Entry: 1wff (more details)

PDB Description: solution structure of the zf-an1 domain from mouse riken cdna 2810002d23 protein
PDB Compounds: (A:) RIKEN cDNA 2810002D23 protein

SCOPe Domain Sequences for d1wffa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wffa1 g.80.1.1 (A:8-79) ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus musculus) [TaxId: 10090]}
ihhlppvkaplqtkkkimkhcflcgkktglatsfecrcgnnfcashryaeahgcnydyks
agrryleeanpv

SCOPe Domain Coordinates for d1wffa1:

Click to download the PDB-style file with coordinates for d1wffa1.
(The format of our PDB-style files is described here.)

Timeline for d1wffa1: