![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.80: AN1-like Zinc finger [118309] (1 superfamily) dimetal(zinc)-bound alpha+beta fold; partial similarity to the Cysteine-rich domain fold (57888) |
![]() | Superfamily g.80.1: AN1-like Zinc finger [118310] (1 family) ![]() |
![]() | Family g.80.1.1: AN1-like Zinc finger [118311] (6 proteins) Pfam PF01428 |
![]() | Protein ANUBL1 (AN1, ubiquitin-like, homolog) [118314] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [118315] (1 PDB entry) Uniprot Q86XD8 732-802 |
![]() | Domain d1wffa1: 1wff A:8-79 [114580] Other proteins in same PDB: d1wffa2, d1wffa3 Structural genomics target complexed with zn |
PDB Entry: 1wff (more details)
SCOPe Domain Sequences for d1wffa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wffa1 g.80.1.1 (A:8-79) ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus musculus) [TaxId: 10090]} ihhlppvkaplqtkkkimkhcflcgkktglatsfecrcgnnfcashryaeahgcnydyks agrryleeanpv
Timeline for d1wffa1: