Lineage for d1wfea_ (1wfe A:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 625707Fold g.80: AN1-like Zinc finger [118309] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold; partial similarity to the Cysteine-rich domain fold (scop_cf 57888)
  4. 625708Superfamily g.80.1: AN1-like Zinc finger [118310] (1 family) (S)
  5. 625709Family g.80.1.1: AN1-like Zinc finger [118311] (6 proteins)
    Pfam 01428
  6. 625710Protein AN1-type zinc finger protein 1 [118312] (1 species)
  7. 625711Species Mouse (Mus musculus) [TaxId:10090] [118313] (1 PDB entry)
  8. 625712Domain d1wfea_: 1wfe A: [114579]
    Structural genomics target
    complexed with zn

Details for d1wfea_

PDB Entry: 1wfe (more details)

PDB Description: solution structure of the 2nd zf-an1 domain of mouse riken cdna 2310008m20 protein

SCOP Domain Sequences for d1wfea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wfea_ g.80.1.1 (A:) AN1-type zinc finger protein 1 {Mouse (Mus musculus)}
gssgssgcsevnvvkerpktdehksyscsfkgctdvelvavicpyceknfclrhrhqsdh
dceklevakprmaatqklvrsgpssg

SCOP Domain Coordinates for d1wfea_:

Click to download the PDB-style file with coordinates for d1wfea_.
(The format of our PDB-style files is described here.)

Timeline for d1wfea_: