Lineage for d1wfea1 (1wfe A:8-80)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038716Fold g.80: AN1-like Zinc finger [118309] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold; partial similarity to the Cysteine-rich domain fold (57888)
  4. 3038717Superfamily g.80.1: AN1-like Zinc finger [118310] (1 family) (S)
  5. 3038718Family g.80.1.1: AN1-like Zinc finger [118311] (6 proteins)
    Pfam PF01428
  6. 3038719Protein AN1-type zinc finger protein 1 [118312] (1 species)
  7. 3038720Species Mouse (Mus musculus) [TaxId:10090] [118313] (1 PDB entry)
    Uniprot Q8BFR6 43-116
  8. 3038721Domain d1wfea1: 1wfe A:8-80 [114579]
    Other proteins in same PDB: d1wfea2, d1wfea3
    Structural genomics target
    complexed with zn

Details for d1wfea1

PDB Entry: 1wfe (more details)

PDB Description: solution structure of the 2nd zf-an1 domain of mouse riken cdna 2310008m20 protein
PDB Compounds: (A:) RIKEN cDNA 2310008M20 protein

SCOPe Domain Sequences for d1wfea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wfea1 g.80.1.1 (A:8-80) AN1-type zinc finger protein 1 {Mouse (Mus musculus) [TaxId: 10090]}
csevnvvkerpktdehksyscsfkgctdvelvavicpyceknfclrhrhqsdhdceklev
akprmaatqklvr

SCOPe Domain Coordinates for d1wfea1:

Click to download the PDB-style file with coordinates for d1wfea1.
(The format of our PDB-style files is described here.)

Timeline for d1wfea1: