SCOP 1.73: Domain d1wfda_: 1wfd A:

Lineage for d1wfda_ (1wfd A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.7: Spectrin repeat-like [46965] (15 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.14: MIT domain [116846] (1 family)

5. Family a.7.14.1: MIT domain [116847] (3 proteins)
   Pfam PF04212
   this is a repeat family; one repeat unit is 1wr0 A:5-81 found in domain

6. Protein Hypothetical protein 1500032H18Rik [116848] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [116849] (1 PDB entry)

8. Domain d1wfda_: 1wfd A: [114578]
   Structural genomics target

Details for d1wfda_

PDB Entry: 1wfd

PDB Description: solution structure of mouse mit domain

PDB Compounds: (A:) Hypothetical protein 1500032H18

SCOP Domain Sequences for d1wfda_:

Sequence; same for both SEQRES and ATOM records:

>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgqdsdstaavavlkraveldaesryqqalvcyqegidmllqvlkgtkesskrcv
lrtkisgymdraenikkyldqekedgksgpssg

Timeline for d1wfda_:

• d1wfda_ first appeared in SCOP 1.71
  
• d1wfda_ appears in SCOP 1.75
  
• d1wfda_ appears in the current release, SCOPe 2.08, called d1wfda1