Lineage for d1wfda1 (1wfd A:8-87)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696892Superfamily a.7.14: MIT domain [116846] (2 families) (S)
  5. 2696893Family a.7.14.1: MIT domain [116847] (4 proteins)
    Pfam PF04212
    this is a repeat family; one repeat unit is 1wr0 A:5-81 found in domain
  6. 2696894Protein Hypothetical protein 1500032H18Rik [116848] (1 species)
  7. 2696895Species Mouse (Mus musculus) [TaxId:10090] [116849] (1 PDB entry)
    Uniprot Q8VDV8 6-87
  8. 2696896Domain d1wfda1: 1wfd A:8-87 [114578]
    Other proteins in same PDB: d1wfda2, d1wfda3
    Structural genomics target

Details for d1wfda1

PDB Entry: 1wfd (more details)

PDB Description: solution structure of mouse mit domain
PDB Compounds: (A:) Hypothetical protein 1500032H18

SCOPe Domain Sequences for d1wfda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wfda1 a.7.14.1 (A:8-87) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]}
qdsdstaavavlkraveldaesryqqalvcyqegidmllqvlkgtkesskrcvlrtkisg
ymdraenikkyldqekedgk

SCOPe Domain Coordinates for d1wfda1:

Click to download the PDB-style file with coordinates for d1wfda1.
(The format of our PDB-style files is described here.)

Timeline for d1wfda1: