![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.15: BRCT domain [52112] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.15.1: BRCT domain [52113] (6 families) ![]() Pfam PF00533 |
![]() | Family c.15.1.5: DNA topoisomerase II binding protein 1, TopBP1 [117468] (1 protein) |
![]() | Protein DNA topoisomerase II binding protein 1, TopBP1 [117469] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117470] (1 PDB entry) Uniprot Q92547 326-444 |
![]() | Domain d1wf6a1: 1wf6 A:8-126 [114576] Other proteins in same PDB: d1wf6a2, d1wf6a3 Structural genomics target |
PDB Entry: 1wf6 (more details)
SCOPe Domain Sequences for d1wf6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wf6a1 c.15.1.5 (A:8-126) DNA topoisomerase II binding protein 1, TopBP1 {Human (Homo sapiens) [TaxId: 9606]} sesicnslnskleptlenlenldvsafqapedlldgcriylcgfsgrkldklrrlinsgg gvrfnqlnedvthvivgdyddelkqfwnksahrphvvgakwllecfskgymlseepyih
Timeline for d1wf6a1: