Lineage for d1wf3a2 (1wf3 A:181-298)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1648684Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 1648733Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 1648734Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)
  6. 1648735Protein GTPase Era C-terminal domain [54818] (3 species)
  7. 1648743Species Thermus thermophilus [TaxId:274] [117915] (2 PDB entries)
    Uniprot Q5SM23
  8. 1648744Domain d1wf3a2: 1wf3 A:181-298 [114575]
    Other proteins in same PDB: d1wf3a1
    Structural genomics target
    complexed with gnp, gol, mg

Details for d1wf3a2

PDB Entry: 1wf3 (more details), 1.88 Å

PDB Description: Crystal structure of GTP-binding protein TT1341 from Thermus thermophilus HB8
PDB Compounds: (A:) GTP-binding protein

SCOPe Domain Sequences for d1wf3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wf3a2 d.52.3.1 (A:181-298) GTPase Era C-terminal domain {Thermus thermophilus [TaxId: 274]}
dyaksdqtfgewvaeilreeamkrlwhevpyavatkveevaerengvlyikailyverps
qkaivigeggrkikeigqatrkqleallgkkvyldlevkvypdwrkdpealrelgyrs

SCOPe Domain Coordinates for d1wf3a2:

Click to download the PDB-style file with coordinates for d1wf3a2.
(The format of our PDB-style files is described here.)

Timeline for d1wf3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wf3a1