Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins) |
Protein GTPase Era C-terminal domain [54818] (2 species) |
Species Thermus thermophilus [TaxId:274] [117915] (2 PDB entries) Uniprot Q5SM23 |
Domain d1wf3a2: 1wf3 A:181-298 [114575] Other proteins in same PDB: d1wf3a1 Structural genomics target complexed with gnp, gol, mg |
PDB Entry: 1wf3 (more details), 1.88 Å
SCOPe Domain Sequences for d1wf3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wf3a2 d.52.3.1 (A:181-298) GTPase Era C-terminal domain {Thermus thermophilus [TaxId: 274]} dyaksdqtfgewvaeilreeamkrlwhevpyavatkveevaerengvlyikailyverps qkaivigeggrkikeigqatrkqleallgkkvyldlevkvypdwrkdpealrelgyrs
Timeline for d1wf3a2: