SCOPe 2.07: Domain d1wf2a1: 1wf2 A:8-92

Lineage for d1wf2a1 (1wf2 A:8-92)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (70 proteins)
   Pfam PF00076
   Pfam PF13893

6. Protein Heterogeneous nuclear ribonucleoproteins C1/C2 [117961] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117962] (1 PDB entry)
   Uniprot P07910 8-92

8. Domain d1wf2a1: 1wf2 A:8-92 [114573]
   Other proteins in same PDB: d1wf2a2, d1wf2a3
   Structural genomics target

Details for d1wf2a1

PDB Entry: 1wf2

PDB Description: solution structure of rrm domain in hnrpc protein

PDB Compounds: (A:) Heterogeneous nuclear ribonucleoproteins C1/C2

SCOPe Domain Sequences for d1wf2a1:

Sequence; same for both SEQRES and ATOM records:

>d1wf2a1 d.58.7.1 (A:8-92) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]}
ktdprsmnsrvfignlntlvvkksdveaifskygkivgcsvhkgfafvqyvnernaraav
agedgrmiagqvldinlaaepkvnr

Timeline for d1wf2a1:

• d1wf2a1 first appeared in SCOP 1.71, called d1wf2a_
  
• d1wf2a1 appears in SCOPe 2.06
  
• d1wf2a1 appears in the current release, SCOPe 2.08