| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
| Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
| Protein Heterogeneous nuclear ribonucleoproteins C1/C2 [117961] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [117962] (1 PDB entry) Uniprot P07910 8-92 |
| Domain d1wf2a1: 1wf2 A:8-92 [114573] Other proteins in same PDB: d1wf2a2, d1wf2a3 Structural genomics target |
PDB Entry: 1wf2 (more details)
SCOPe Domain Sequences for d1wf2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wf2a1 d.58.7.1 (A:8-92) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]}
ktdprsmnsrvfignlntlvvkksdveaifskygkivgcsvhkgfafvqyvnernaraav
agedgrmiagqvldinlaaepkvnr
Timeline for d1wf2a1: