Lineage for d1wf2a1 (1wf2 A:8-92)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2951924Protein Heterogeneous nuclear ribonucleoproteins C1/C2 [117961] (1 species)
  7. 2951925Species Human (Homo sapiens) [TaxId:9606] [117962] (1 PDB entry)
    Uniprot P07910 8-92
  8. 2951926Domain d1wf2a1: 1wf2 A:8-92 [114573]
    Other proteins in same PDB: d1wf2a2, d1wf2a3
    Structural genomics target

Details for d1wf2a1

PDB Entry: 1wf2 (more details)

PDB Description: solution structure of rrm domain in hnrpc protein
PDB Compounds: (A:) Heterogeneous nuclear ribonucleoproteins C1/C2

SCOPe Domain Sequences for d1wf2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wf2a1 d.58.7.1 (A:8-92) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]}
ktdprsmnsrvfignlntlvvkksdveaifskygkivgcsvhkgfafvqyvnernaraav
agedgrmiagqvldinlaaepkvnr

SCOPe Domain Coordinates for d1wf2a1:

Click to download the PDB-style file with coordinates for d1wf2a1.
(The format of our PDB-style files is described here.)

Timeline for d1wf2a1: