Lineage for d1wf1a_ (1wf1 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908439Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1908722Protein RNA-binding protein Raly (Autoantigen p542) [117959] (1 species)
  7. 1908723Species Human (Homo sapiens) [TaxId:9606] [117960] (1 PDB entry)
    Uniprot Q9UKM9 1-97
  8. 1908724Domain d1wf1a_: 1wf1 A: [114572]
    Structural genomics target

Details for d1wf1a_

PDB Entry: 1wf1 (more details)

PDB Description: solution structure of rrm domain in rna-binding protein np_057951
PDB Compounds: (A:) RNA-binding protein Raly

SCOPe Domain Sequences for d1wf1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wf1a_ d.58.7.1 (A:) RNA-binding protein Raly (Autoantigen p542) {Human (Homo sapiens) [TaxId: 9606]}
gssgssgmslklqasnvtnkndpksinsrvfignlntalvkksdvetifskygrvagcsv
hkgyafvqysnerharaavlgengrvlagqtldinmagepkpdrsgpssg

SCOPe Domain Coordinates for d1wf1a_:

Click to download the PDB-style file with coordinates for d1wf1a_.
(The format of our PDB-style files is described here.)

Timeline for d1wf1a_: