Lineage for d1wf1a1 (1wf1 A:8-104)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952157Protein RNA-binding protein Raly (Autoantigen p542) [117959] (1 species)
  7. 2952158Species Human (Homo sapiens) [TaxId:9606] [117960] (1 PDB entry)
    Uniprot Q9UKM9 1-97
  8. 2952159Domain d1wf1a1: 1wf1 A:8-104 [114572]
    Other proteins in same PDB: d1wf1a2, d1wf1a3
    Structural genomics target

Details for d1wf1a1

PDB Entry: 1wf1 (more details)

PDB Description: solution structure of rrm domain in rna-binding protein np_057951
PDB Compounds: (A:) RNA-binding protein Raly

SCOPe Domain Sequences for d1wf1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wf1a1 d.58.7.1 (A:8-104) RNA-binding protein Raly (Autoantigen p542) {Human (Homo sapiens) [TaxId: 9606]}
mslklqasnvtnkndpksinsrvfignlntalvkksdvetifskygrvagcsvhkgyafv
qysnerharaavlgengrvlagqtldinmagepkpdr

SCOPe Domain Coordinates for d1wf1a1:

Click to download the PDB-style file with coordinates for d1wf1a1.
(The format of our PDB-style files is described here.)

Timeline for d1wf1a1: