![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein RNA-binding protein Raly (Autoantigen p542) [117959] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117960] (1 PDB entry) Uniprot Q9UKM9 1-97 |
![]() | Domain d1wf1a1: 1wf1 A:8-104 [114572] Other proteins in same PDB: d1wf1a2, d1wf1a3 Structural genomics target |
PDB Entry: 1wf1 (more details)
SCOPe Domain Sequences for d1wf1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wf1a1 d.58.7.1 (A:8-104) RNA-binding protein Raly (Autoantigen p542) {Human (Homo sapiens) [TaxId: 9606]} mslklqasnvtnkndpksinsrvfignlntalvkksdvetifskygrvagcsvhkgyafv qysnerharaavlgengrvlagqtldinmagepkpdr
Timeline for d1wf1a1: