Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
Protein TAR DNA-binding protein 43, TDP-43 [117957] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117958] (2 PDB entries) Uniprot Q13148 193-267 |
Domain d1wf0a1: 1wf0 A:8-82 [114571] Other proteins in same PDB: d1wf0a2, d1wf0a3 Structural genomics target |
PDB Entry: 1wf0 (more details)
SCOPe Domain Sequences for d1wf0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wf0a1 d.58.7.1 (A:8-82) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} vfvgrctgdmtedelreffsqygdvmdvfipkpfrafafvtfaddqiaqslcgedliikg isvhisnaepkhnsn
Timeline for d1wf0a1: