Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
Protein Calcipressin-1 [117953] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [117954] (1 PDB entry) Uniprot Q9JHG6 14-103 |
Domain d1weya1: 1wey A:8-98 [114569] Other proteins in same PDB: d1weya2, d1weya3 Structural genomics target; splicing variant |
PDB Entry: 1wey (more details)
SCOPe Domain Sequences for d1weya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1weya1 d.58.7.1 (A:8-98) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} liacvanddvfsesetrakfeslfrtydkdttfqyfksfkrvrinfsnplsaadarlrlh kteflgkemklyfaqtlhigsshlappnpdk
Timeline for d1weya1: