Lineage for d1weya1 (1wey A:8-98)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2951874Protein Calcipressin-1 [117953] (1 species)
  7. 2951875Species Mouse (Mus musculus) [TaxId:10090] [117954] (1 PDB entry)
    Uniprot Q9JHG6 14-103
  8. 2951876Domain d1weya1: 1wey A:8-98 [114569]
    Other proteins in same PDB: d1weya2, d1weya3
    Structural genomics target; splicing variant

Details for d1weya1

PDB Entry: 1wey (more details)

PDB Description: solution structure of rrm domain in calcipressin 1
PDB Compounds: (A:) calcipressin 1

SCOPe Domain Sequences for d1weya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1weya1 d.58.7.1 (A:8-98) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]}
liacvanddvfsesetrakfeslfrtydkdttfqyfksfkrvrinfsnplsaadarlrlh
kteflgkemklyfaqtlhigsshlappnpdk

SCOPe Domain Coordinates for d1weya1:

Click to download the PDB-style file with coordinates for d1weya1.
(The format of our PDB-style files is described here.)

Timeline for d1weya1: